[ 3 / biz / cgl / ck / diy / fa / ic / jp / lit / sci / vr / vt ] [ index / top / reports ] [ become a patron ] [ status ]
2023-11: Warosu is now out of extended maintenance.

/vt/ - Virtual Youtubers


View post   

File: 175 KB, 939x1200, FENnC85agAIcl4e.jpg large.jpg [View same] [iqdb] [saucenao] [google]
13069770 No.13069770 [Reply] [Original]

his is a thread for the discussion of Nijisanji's English branch and their vtuber units, LazuLight, Obsydia and Ethyria!

Nijisanji EN Youtube channels:
https://www.youtube.com/channel/UC-JSeFfovhNsEhftt1WHMvg/channels

Twitter accounts:
https://twitter.com/NIJISANJI_World
https://twitter.com/PomuRainpuff
https://twitter.com/EliraPendora
https://twitter.com/FinanaRyugu
https://twitter.com/Rosemi_Lovelock
https://twitter.com/Petra_Gurin
https://twitter.com/Selen_Tatsuki
https://twitter.com/MillieParfait
https://twitter.com/EnnaAlouette
https://twitter.com/NinaKosaka
https://twitter.com/ReimuEndou

Teamup Schedule for Nijisanji:
https://teamup.com/ks1mraas71v3fjf1c2
https://walfie.github.io/niji-en-pinned/

To watch streams at the same time:
https://holodex.net/
https://niji-mado.web.app/home
Open devtools (F12 key), go to console tab, input the following code, then refresh the page.
localStorage.setItem('rulePauseOther', 0);
You only need to do this once, or until your browser data is cleared.

NijiEN song playlist:
https://youtube.com/playlist?list=PLZ-k6IRXJh-H_Kx_t2qdG-O19hPtIUp3r
To loop indefinitely get a browser extension preventing Youtube autopause.

Reminder to ignore shitposting, discordfags, and tribalfags.
Previous thread: >>13051321

>> No.13072767

yuck nina in the op

>> No.13072779

>>13072767
get filtered, fag.

>> No.13072781
File: 166 KB, 1280x720, FBk2G1rXEAAENdq.jpg [View same] [iqdb] [saucenao] [google]
13072781

I LOVE NINA

>> No.13072796

god I NEED to rape Pentomos right now!

>> No.13072799

>>13072676
Pomu (Forma de Ira de Asalariada) or Pomu (Forma de Asalariada Furiosa)
Among other posibilities desu.

>> No.13072805
File: 1.38 MB, 1365x886, 1635941665187.png [View same] [iqdb] [saucenao] [google]
13072805

I LOVE POMU!!!!!!!!!!!!!!!!!!!!!!!!

>> No.13072812

Why didn't she just stay in Tsunderia? Why didn't she care about putting in effort with them? Honest question.

>> No.13072838

>>13072812
good question, ask kanafags.

>> No.13072843

>>13072805
as well as pentomos

>> No.13072845

>>13072812
>be in a deadend company
>be in a good company
gee anon... I don't know...

>> No.13072847 [DELETED] 

Wow Finana, don't call Nina monkeyism on stream

>> No.13072848

>>13072767
yuck faggot in the thread

>> No.13072851
File: 121 KB, 285x203, ninastroke.png [View same] [iqdb] [saucenao] [google]
13072851

>>13072781
NIIINNNAAAA

>> No.13072884

the op has the two worst in en, what a fag.

>> No.13072890

>>13072812
that's like putting in effort in coal mining when you get offered a white collar job

>> No.13072900

>>13072812
She didn't like doing collabs because of social anxiety and seems to prefer streaming on twitch anyway.

>> No.13072908
File: 890 KB, 964x1236, flat is justice.png [View same] [iqdb] [saucenao] [google]
13072908

Pomu I need you in my life

>> No.13072911

>>13072884
I don't see Selen and Rosemi up there.

>> No.13072916

>A JP senpai asked me to record stuff for them
Holy shit, Nina's moving up the ladder.

>> No.13072922

>>13072812
Kana had mental problems, thats why she left.

>> No.13072923

>>13072708
I never said I'm educated consumer, I'm just stingy. Also I don't feel like my lifespawn is worth a shit so as long as I enjoy it I don't mind

>> No.13072928

MILLIE SNEEZE AAAA

>> No.13072935

>"A JP senpai requested I record something for them."
Going up in the world

>> No.13072936
File: 347 KB, 2048x2048, E7jCe1LVcAIoYO9.jpg [View same] [iqdb] [saucenao] [google]
13072936

Pomu I need you as my wife

>> No.13072953

CEO repaying NijiEN for Pomu hitting homeruns!

>> No.13072961

ethryia is such a failure that a grifter is going to end up with twice the subs as the next person. thanks Elira, you fucking moron.

>> No.13072965

>>13072923
>I don't feel like my lifespawn is worth a shit
Nothing worst than a self-hating loser.

>> No.13072975

you think Selen will finish Alice before the Lazu collab?

>> No.13072977

https://twitter.com/finanaryugu/status/1460330151921827843?s=21
Say something nice about my wife

>> No.13072991

>>13072916
>>13072935
My bet is Fumi

>> No.13072999

>>13072977
she's almost as cute as the Pentomos!

>> No.13073005

>>13072965
Isn't that most fags here?

>> No.13073010

>>13072977
she has noodle arms.

>> No.13073016

>>13072923
>don't feel like my lifespawn is worth a shit
sorry for (You) anon, I hope your life gets better

>> No.13073052

>>13072977
She doesnt make me hard

>> No.13073059

>>13072935
ROUND THE WORLD, ROUND THE WORLD
BAM PARA RAM PAM PA PARAM

>> No.13073071

>>13072965
It's not about self-hating, lifespawn is worth nothing since one day you will die anyway and not a single thing you've done will mean anything anymore. Just enjoy the moment however you like

>> No.13073099

selen sit your fat fuckin ass on my face so I can get a nice smell of your pugnant gamer aroma mmmm

>> No.13073098

>>13072977
Noodle arms!

>> No.13073108

>>13073099
this but with a pentomo

>> No.13073129

Why the fuck did Finana get subs faster than Selen, or even Pomu.

>> No.13073139
File: 2.38 MB, 2500x2800, pomu hungers.jpg [View same] [iqdb] [saucenao] [google]
13073139

>>13073071
I am going to hunt you down and rape you to death because it brings me pleasure unless you SC your bank account to my oshi

>> No.13073177
File: 1.57 MB, 365x658, 1.webm [View same] [iqdb] [saucenao] [google]
13073177

Rosemi is the cutest!

>> No.13073197

>>13073099
Bobon...

>> No.13073203

This thread never watches streams.

>> No.13073222

>>13073129
She's not getting subs faster than Selen though, she has 2 months advantage over her. As for Pomu, her break and clippers becoming inactive have had a massive impact on her subgrowth.

Also Finana is a better streamer than Selen

>> No.13073243

I should buy a pentomo for myself and give it... a test run.

>> No.13073244

>>13073177
Selen would beg to differ, Selen is cuter

>> No.13073256

>>13073177
hey bud, did we get a good morning tweet today?

>> No.13073257

I just bought Pomu in the jar. She claims she will only eat my semen, but she also needs some fruits and veggies yet she refuses them! Help me guys, Im afraid my Pomu might get sick! At least she going to be buff from all the protein...

>> No.13073263

>>13073129
Fast than Selen because two month head-start, plus her first Genshin stream where she did a lot of gacha hit algorithm, got a ton of subs from that. Selen is catching up though, could see her passing Finana early next year.
Faster than Pomu because western vtuber audiences seem to care more about gamers than about non-gamers. That and Susan has always had it out for Pomu,

>> No.13073267

Chances of Pomu going menhera today?

>> No.13073269
File: 326 KB, 2048x1551, 1630048657744.jpg [View same] [iqdb] [saucenao] [google]
13073269

watching Rosemi do so well for a first timer at the arcade donkey kong games and the original super mario bros. is pretty impressive, she really is the best gamer in the entire branch and nobody can argue otherwise

>> No.13073285

>>13073129
who the hell cares? Subs don't mean shit imo, they are just a stat you show off to "prove" whose better to losers who actually think mores subs = better content.

>> No.13073290

>>13073222
Rosebud hands typed this

>> No.13073292

>>13073243
you should, they come with their own bottle of lube too!

>> No.13073316

>>13073222
yeah, no. Selen is the better streamer and all statistics point to that when she collabs with Fish, for example.

>> No.13073318

>>13073267
From what? Her work project is over. She was fine in yesterday's stream.

>> No.13073319

>>13073139
I blame Pentomos for this

>> No.13073320
File: 34 KB, 720x400, 1636558885728.jpg [View same] [iqdb] [saucenao] [google]
13073320

Numberfags and holoschizos are the same people

>> No.13073360

well one positive thing about the Crab Game stream, I think this entire board knows who Pomu Rainpuff is now lol

>> No.13073364

https://twitter.com/FinanaRyugu/status/1460303835596005378
wonder what finana thought up

>> No.13073379

>>13073320
what a shock, not like that was common knowledge to anyone who has spent time in this thread long enough to notice that.

>> No.13073383

>>13073129
Debuted earlier and generally appeals more to the interests of the Western vtuber fans with her viral clips.
Selen will probably overtake her and even Elira at some point though since she has a broader audience.
Also, what >>13073222 said in his spoiler

>> No.13073384
File: 661 KB, 799x763, 1633418474241.png [View same] [iqdb] [saucenao] [google]
13073384

I love Rosemi-sama!

>> No.13073395

>>13073364
amogus

>> No.13073402

>>13073364
Finaner? I hardly know er

>> No.13073403

>>13073360
she got 200 hatemaros from it, probably

>> No.13073405
File: 350 KB, 1448x2048, FDCQzd3aMAAlpAq.jfif.jpg [View same] [iqdb] [saucenao] [google]
13073405

I love my daughterwife!

>> No.13073413

>>13073360
Everything about the Crab Game stream was great. Thinking that people on this board knowing about our livers is more important than the entertainment value of the collab itself really shows where your priorities are at though.

>> No.13073417

>>13073256
yes we did! https://twitter.com/Rosemi_Lovelock/status/1460265607509729295

>> No.13073419

>>13073360
it was a shitshow? I didn't think it was.

>> No.13073423

>>13073360
BASED. Pomu is now living in their heads, dancing on their cerebellum, deleting math knowledge

>> No.13073424

>>13073364
Perhaps... raping pentomos... on stream...?

>> No.13073436

>>13073316
>numbers prove who's the better streamer
Thank god I'm not brain dead, tell me when Selen gets invested into a game properly, and I'll consider her a better steamer.
>>13073290
I prefer Selen over Rosemi at least kek

>> No.13073438
File: 67 KB, 675x900, 1636467543603.jpg [View same] [iqdb] [saucenao] [google]
13073438

I love my 200k subs feesh, and you should too.

>> No.13073450

>>13072935
>>13072916
Good for her, wonder who it is?

>> No.13073455

>Finana is the better streamer
Don't make me laugh.

>> No.13073470

>>13073423
I'm Pomu!
It's like the end result of a hypnotism fetish

>> No.13073467
File: 196 KB, 283x297, 1634236960683.png [View same] [iqdb] [saucenao] [google]
13073467

6am, gn bros

>> No.13073489

>>13072961
The effect of actually trying things outside the usual mold, funny.

>> No.13073491

>>13072812
She didn't get along with them supposedly.
Not like actual drama but they just didn't bond and she felt isolated. Besides Tsunderia was kind of a black company when it first started out. The other girls have talked about how bad it was before the management got their shit together.

>> No.13073494

>>13073455
if you're /v/ she absolutely is because she gets incredibly invested in games.

>> No.13073497

>>13073436
ok hipster

>> No.13073508

>>13073417
cute!

>> No.13073509
File: 182 KB, 1170x1170, 1631484739170.jpg [View same] [iqdb] [saucenao] [google]
13073509

stop tribalfagging you stupid retards

>> No.13073527

>>13073129
She debuted before Selen and Pom's break fucked her growth.

>> No.13073541

>come home after a long day of work
>open the door, throw blazer on the sofa
>smell something good
>go to kitchen
>it's my pentomo bussy making a delectable dinner for me after a long hard day of work
>begin raping his butt while he makes my dinner, the slapping sounds echo through the house as the thrusts interrupt with the pentomo's ability to make dinner
>eat the dinner off pentomo's back using only my tongue and then kissing pentomo on the cheek and feeding the pentomo like a mommy bird
>finally leading the pentomo to the cage for the night before I wake up and repeat the process the next morning

>> No.13073559

la palma looking hot today.

>> No.13073563

>>13073541
Kill yourself

>> No.13073575

I want to wape Wosemi!

>> No.13073586

>>13073563
It was still a better post than the tribalfag shit

>> No.13073614

>>13073541
Can this pentomo bullshit please die.

>> No.13073626

>>13073586
Your shit isn't any less stinky

>> No.13073628

What's the dumbest dad joke that would make Elira laugh?

>> No.13073642

I have cast iron and I scrub it with soapy water.
The only maintenance I do is some light seasoning on the stove and drying it out after washing it.

>> No.13073643

https://www.youtube.com/watch?v=3d67917nm-Y

>> No.13073684

>>13073586
Tribalfaggotry and numberfaggotry would be preferable to >dude pentomoxD

>> No.13073687

Nina is my favourite hag!

>> No.13073703

Millie assumed her viewers are all unwashed gamer manchildren

>> No.13073707

>>13073491
I thought the black company start up was Prism.

>> No.13073716

>>13073614
Most of it today has been one guy trying to make everyone as annoyed with the meme as he is.

>> No.13073719

Gamers are the most oppressed

>> No.13073747

You know Millie's pretty good. I think I had the wrong opinion about her.

>> No.13073760

>>13073703
No shit she gets a lot of hate. She herself hates her community.

>> No.13073767

>>13073687
mio is 100x better but ok.

>> No.13073777
File: 146 KB, 1223x1000, Happy Ursalen.jpg [View same] [iqdb] [saucenao] [google]
13073777

Selen soon!

>> No.13073789

>>13073684
If I could replace every tribalfag and numberfag with a pentomophile I would

>> No.13073791

>>13073684
no

>> No.13073794

>>13073703
She's not wrong

>> No.13073805

>>13073707
Prism's problem is just that the boss is an idiot.
Tsunderia had a lot of problems early on including financial ones that made them unsure if the company would even survive very long.

>> No.13073810

>>13073767
Rin's the better hag to Mio but they're all pretty good

>> No.13073817

>Petra got a new clipper
Pomu is literally untrampled snow for clips; what gives.

>>13073716
>today
Since the beginning

>> No.13073843

>>13073817
Is the new clipper a cute pentomo?

>> No.13073851

I seriously think Millie should make more of an effort to play her character. She can sound like a peppy and upbeat little witch character if she wants. Hearing a 30 year old in a loli body is a bit jarring.

>> No.13073853

>>13073805
I see. I don't know much about them to be honest, all I heard was about Prism's quota thing and management demands

>> No.13073857

>>13073614
its homos pushing it

>> No.13073866

>>13073794
she couldn't be more wrong, her content does not attract /v/ermin

>> No.13073873

The dragoons are evolving quickly.

>> No.13073882
File: 176 KB, 1099x953, Alice Selen4.jpg [View same] [iqdb] [saucenao] [google]
13073882

MY WIFE SELEN IS ABOUT TO FINISH ALICE!
PLEASE SUPPORT HER!

https://www.youtube.com/watch?v=hyiovLDx8iY
https://www.youtube.com/watch?v=hyiovLDx8iY
https://www.youtube.com/watch?v=hyiovLDx8iY

>> No.13073881

>>13073851
This actually fits her lore though.

>> No.13073888

>>13073851
She is upbeat unless she's going full doomer talk. She's always laughing her ass off during collabs

>> No.13073908

I'm sending one maro to Pomu every time Millie does this offensive southern accent

>> No.13073917

WTW I WANT TO RAPE A PENTOMO NOW, WHAT DID YOU DO TO ME

>> No.13073930

>>13073908
Love Maro or Hate Maro?

>> No.13073934

>>13073917
I want to rape a numberfag

>> No.13073945
File: 47 KB, 500x500, 1616316040991.jpg [View same] [iqdb] [saucenao] [google]
13073945

>>13073817
Watch Pomu's membership stream. Nearly every single big Pomudachi is a wagie who doesn't have time to clip and even Pomu knows that. You basically need to be lucky enough to have some SEA fans to get clippers.

>> No.13073949

>outright states she dislikes one of the managers
it's the wave 3 manager, right?
the lazulight and obsydia manager hasn't really had any complaints from any of the girls before

>> No.13073952

>>13073930
Tough Love

>> No.13073959

>>13073851
>Hearing a 30 year old in a loli body is a bit jarring.
you're thinking about enna
Millie is pretty damn upbeat and perky

>> No.13073981

Real tribal talk. Why doesn't Finana get enough pregers art? or egg birthing with a ugly bastard fertilizing the egg pile?

>> No.13073982

Millie should just open up maros and do maro zatsutalk and roasting anti maros on stream and laughing at kusomaros.
Yes I want her to go full Kenmochi

>> No.13073985

>>13073917
Pentomophilia simply can't be contained

>> No.13073990

>>13073949
of course it is, who else would it be. Every other girl in previous waves said how nice the managers and staff are

>> No.13074019

>>13073908
I don't think Pomu would get mad at Millie for doing a southern accent.

>> No.13074024

selen's mom?!?!

>> No.13074026

>>13073982
Pomu already fills that spot in EN

>> No.13074029

>>13073949
Wish we had a better idea of how many managers they have and who all shares one. LazuObs seemed to only have one manager, but maybe it's different now, since Millie mentioned multiple managers, or maybe she's confusing mane-san and staff-san and calling them all managers.

>> No.13074040

>>13073982
>full Kenmochi
That requires her to have a girlier laugh

>> No.13074049

>>13073981
be the change you want to see, commission an artist

>> No.13074058

It is so heartwarming to see how supportive and helpful Selen mom's is. Everyone should have a mom like that.

>> No.13074070

>>13073949
I heard her say that but I was assuming I heard wrong and she was talking about her wagie managers from when she was working fast food/retail.
If she actually was talking about her Niji managers I worry for her future. She even said she'd never willingly quit Nijisanji unless they fire her....that was pretty ominous.

>> No.13074076
File: 70 KB, 250x250, Selen Cry.png [View same] [iqdb] [saucenao] [google]
13074076

Allergies...

>> No.13074080
File: 340 KB, 480x528, Selen Gosling3.png [View same] [iqdb] [saucenao] [google]
13074080

Selen sounds like she's been crying all night...

>> No.13074082

>>13074058
lmao

>> No.13074100

>>13073817
No one cares for her? lol.

>> No.13074102

>>13074058
oh anon... if this is bait I salute you

>> No.13074111
File: 48 KB, 229x70, 1606816199773.png [View same] [iqdb] [saucenao] [google]
13074111

Selen's a 2view now...

>> No.13074125

>>13074058
rrats???

>> No.13074129
File: 64 KB, 256x256, selinlol 3.png [View same] [iqdb] [saucenao] [google]
13074129

>>13074058
nice bait made me reply 10/10

>> No.13074157

>>13074111
Dragonbros...did we get too cocky?

>> No.13074179

>>13073945
If she doesn't get a new clipper by Dec 11th, I'll start clipping her. Got nothing else lined up after semester end

>> No.13074188

>>13074111
Dragonbros...did we get too cocky?

>> No.13074206

>>13074157
this game is just boring to watch, i got sleepy in the middle of the day last time

>> No.13074232

>>13074049
All my money is going into pentomo art in Skeb, though.

>> No.13074240

alice...

>> No.13074245

>>13073383
>Selen
>Broader audience than Elira
This is just objectively false. Elira is the jack of all trades of NijiEN, Selen has cornered the Apex/FPS market.

>> No.13074253

>>13073643
I got jumpscared so hard in this part since I was alt-tabbed

>> No.13074256

>>13074111
Interesting comparison, with Selen being Niji EN's top streamer and Kiara being Holo EN's worst (or 2nd worst) streamer, playing the same game in roughly the same timeslot within a few weeks of each other. About of neutral of conditions as you can get.

>> No.13074261

the olden days was kinda fucked

>> No.13074262

Schizo game...

>> No.13074270

>>13073794
She is though. Most of them are friendless socially awkward virgins, but not necessarily dirty gamer neets.

>> No.13074278

>>13074070
pretty sure Millie has power due to her connections with Elira and how big she was before joining Nijisanji

>> No.13074280

>>13074102
WHAT DO YOU MEEEEEEEEAAAAANNN? But seriously I don't think any other nijiEN girl has a mom that is so supportive. Selen's mom seems to be very involved and it like a breath of fresh air to find parents that are supportive of their children when it comes to vtubing. I would have thought most parents now would be pretty unhappy that their child is a youtuber.

>> No.13074313
File: 276 KB, 2000x2000, 1622341738708.jpg [View same] [iqdb] [saucenao] [google]
13074313

>>13073817
We're too busy working to provide for Pomu

>> No.13074329

>>13074245
/v/tards always think they're the biggest audience for anything

>> No.13074341

Even if you were rich in those times... is still shit

>> No.13074342

>>13074111
Is Alice such a debuff?

>> No.13074372

Watching Selen play a story driven game with a dark tone like this feels somehow like something is off.

>> No.13074378

>>13073945
I'm a NEET and a Pomudachi but I don't like making clips because adding subtitles and editing and shit is too much effort.

>> No.13074380

>>13074111
Selen is about to pass her in viewers soon

>> No.13074382

>>13074342
Those were always her regular numbers, she's been farming the shit out of buff games lately between her Apex streams, her horror game streams, and that meme stream of Peppa Pig

>> No.13074387
File: 74 KB, 657x802, Enna_love[sound=files.catbox.moe%2Fgph58b.mp3].jpg [View same] [iqdb] [saucenao] [google]
13074387

How is this possible for someone to be so delightfully vibrant and beautiful as Enna? She shines like an unshakable beacon of bright, pure light. When this angelic being looks at you, a feeling of hopefulness and calmness overwhelms your soul. Truly, it's an honor to be blessed by her gaze. When Enna sings, your whole being tends to be engulfed in a flame of pure joy and happiness. She has a voice that pierces the heaven itself. A voice that belongs to the goddess...

>> No.13074393

>>13074342
She went live 10 minutes ago.

>> No.13074395

Hey faggot dragoons your tranny oshi is live

>> No.13074411

>>13074395
tranny?

>> No.13074426

>>13074382
Well, not THOSE numbers, but not nearly the outliers that she's had lately. Stop screenshotting noombers 5 minutes into a stream, fags

>> No.13074466

Wait they made Alice in Wonderland a platformer? Lol what

>> No.13074476

>>13074378
No need to add subtitles, and don't really need to do much editing outside of cutting out any unimportant dead air

>> No.13074486

>if you live by the ocean it's fact you know how to swim
Don't tell them about niggers in the south. Literally saw one almost drown in a 5ft swimming pool on a school trip back in elementary school.

>> No.13074489
File: 37 KB, 1480x502, 1615076263045.png [View same] [iqdb] [saucenao] [google]
13074489

>>13074256
Selen has been a retard with this game and streamed it in three different timeslots within 4 days, there's no way she was going to maintain an audience like this.
>>13074342
It's bait, she just started streaming, but yea the game is also a debuff, the first stream only peaked at 1.9k
>>13074382
This is true, but I think it's still a slight debuff, her normal numbers should be around 2k

>> No.13074490

>>13074387
I read this in Enna's lore voice

>> No.13074502

>>13073316
why are dragoons like this

>> No.13074506

>>13074387
god her flat chest, it's so desirable

>> No.13074507

>>13074411
People from certain board are very obsessed about trans people anon.

>> No.13074540

>>13073316
>Noombers = quality
You Holobronies need to leave.

>> No.13074542

Is selen having trouble laughing for some reason? Is something wrong?

>> No.13074548
File: 924 KB, 773x1043, b11abgL[1].png [View same] [iqdb] [saucenao] [google]
13074548

adorable

>> No.13074554

>>13074489
Yeah, for this series in specific... she played 3 streams in 3 different timezones. I predict 1500-1600 peak for this stream

>> No.13074572

Can't believe I'm saying this but I think I need to fuck pentomos in the ass.

>> No.13074589

>>13074542
> Is something wrong?
Her life.

>> No.13074590

I know it's not technically EN but Hana's new smug expression makes my pp hard

>> No.13074591

All of Alice's outfits are so wonderful. All girls should dress like this.

>> No.13074593

>>13074542
everything is wrong in her life and she's about to kill herself

>> No.13074595

>>13074489
to be perfectly blunt, the game looks like shit

>> No.13074606
File: 311 KB, 1920x1080, 1623619837707.jpg [View same] [iqdb] [saucenao] [google]
13074606

https://twitter.com/Rosemi_Lovelock/status/1460340435277291527
Lots of interesting stuff this week.

>> No.13074619

>>13074542
she fucked her voice
which is ironic after she worried so much about it

>> No.13074623
File: 1004 KB, 4000x4000, 1627769025324.jpg [View same] [iqdb] [saucenao] [google]
13074623

>>13074591
I agree

>> No.13074634

>>13074619
What happen?

>> No.13074643
File: 98 KB, 595x842, 1636993241040.jpg [View same] [iqdb] [saucenao] [google]
13074643

>>13074606
ASTRONOMY STREAM!!!!

Rosemi!!! I LOVE YOU SWEET DORK!!

>> No.13074649
File: 724 KB, 2897x4096, 1636234334001.jpg [View same] [iqdb] [saucenao] [google]
13074649

wosemi cute

>> No.13074657

>>13074486
Historically community pools and beaches were racially segregated. Once the civil rights act came down white neighborhoods started draining/filling their pools and just moving to private clubs and private beaches to continue racially segregating. Black people can't swim because their grandparents and parents never learned how to swim so they actively avoid water for vacations and shit, preventing their children from ever learning how to swim too.

>> No.13074659 [DELETED] 
File: 454 KB, 1080x1506, Enna...jpg [View same] [iqdb] [saucenao] [google]
13074659

ENNA????
https://www.pixiv.net/en/artworks/94148160

>> No.13074665

>>13074659
abayo birdfucker

>> No.13074664

>>13074634
I don't know? Maybe her voice is naturally weaker + allergies. She also screamed a lot with Dead Space and RE2.

>> No.13074668

>>13074634
it's nothing, she just has allergies.

>> No.13074677
File: 3.71 MB, 2600x2750, 94003901_p2.png [View same] [iqdb] [saucenao] [google]
13074677

>>13074659
Anon...you forgot something...

>> No.13074691
File: 610 KB, 802x802, 1630734528283.png [View same] [iqdb] [saucenao] [google]
13074691

>>13074606
Holy shit, every single stream this week is going to be amazing. Everhood is such a great choice, that game is awesome

>> No.13074697

>>13074677
based

>> No.13074716

>>13074677
>>13074659
>enna/selen posters are feetfags
explains a lot

>> No.13074732 [SPOILER] 
File: 551 KB, 636x636, file.png [View same] [iqdb] [saucenao] [google]
13074732

>>13074606
Did she already forget he existed?

>> No.13074733
File: 411 KB, 468x544, 1636844851826.png [View same] [iqdb] [saucenao] [google]
13074733

>>13074659
nipples

>> No.13074745

>>13074606
>rosemi asmr
I need to clear my schedule

>> No.13074751

Selen...

>> No.13074753

I only watched Enna trough collabs, which of her solo streams would you recommend ?

>> No.13074755

>>13074732
Genuinely kill yourself

>> No.13074765

>>13074664
I been a fan of a couple streamers and followed them from their beginnings to being pretty popular figures.

All of them went through a period when their voice broke and they became super hoarse for a month or so. This happened every time, because once they started speaking a lot every day eventually their voice wore out. But it always came back stronger. It's something that only happened once to each of them, it was like a metamorphosis for their voice. Maybe this is happening to selen.

>> No.13074768

>>13074732
who the fuck is that? why would she care about some random hamster that looks nothing like king-sama

>> No.13074774
File: 773 KB, 635x635, 1626234165607.png [View same] [iqdb] [saucenao] [google]
13074774

>this game

>> No.13074790
File: 3.28 MB, 2370x2000, DEFDDAD9-E64C-4522-99C1-449B2B777A6F.jpg [View same] [iqdb] [saucenao] [google]
13074790

>>13074716
>Only those two
You sure anon? Ryuguards have a folder for Finana’s feet on their mega

>> No.13074793
File: 318 KB, 1479x2048, FDvJ6YvagAEafJ-.jpg [View same] [iqdb] [saucenao] [google]
13074793

>>13074732
King is dead, hes gone.
but hes in rosemi's heart.
he lives on as a part of her.

>> No.13074798
File: 820 KB, 665x611, 1624764157836.png [View same] [iqdb] [saucenao] [google]
13074798

ENTER MY VAGINA

>> No.13074810

>>13074765
Except she has been streaming for past 3 or more years?

>> No.13074812

This selen is different from the selen I used to know. Her laugh is weaker, she seems off somehow. Maybe her IRL drama is catching up with her

>> No.13074828

>>13074659
You made an effort but man you forgot to censor something else
Mods please don’t ban him

>> No.13074848

>>13074812
It's her day.

>> No.13074849

>>13074793
Did she absorb him by hugging his dead body for 2 hours?

>> No.13074867

>>13074659
kek

>> No.13074868

>>13074849
no, he became fertilizer for her you idiot.

>> No.13074871

>>13074798
no bussy, no go
all in on pentomocoin right now

>> No.13074883
File: 736 KB, 850x1200, 1636782909212.png [View same] [iqdb] [saucenao] [google]
13074883

>>13074798
Yes ma'am

>> No.13074902
File: 3.59 MB, 2480x3508, 1636559175306.png [View same] [iqdb] [saucenao] [google]
13074902

>>13074716
Step on me Pomu. Put your 9cm heels to good use.

>> No.13074905
File: 289 KB, 1067x649, Selen HUMPH.jpg [View same] [iqdb] [saucenao] [google]
13074905

Ok Selen, i will watch an Alice VaatiVidya after your stream

>> No.13074910

>>13074883
please, please don't. I'm nofap right now

>> No.13074911
File: 527 KB, 520x570, 1614446854054.png [View same] [iqdb] [saucenao] [google]
13074911

>>13074798
And never be able to go free again? Never.

>> No.13074913

>>13074812
You have to ask yourself what good is Ember if he can't lick her pussy properly to make her relax and relieve the stress. I bet that fucker isn't even drawing aggro from her mom properly like he did in the past. He really doesn't deserve her.

>> No.13074933 [DELETED] 

Why did Elira betrayed us for seaniggers? Why... was it worth?

>> No.13074937
File: 19 KB, 128x128, 1626474581562.gif [View same] [iqdb] [saucenao] [google]
13074937

>>13074798
I'm gonna enter it with my tongue

>> No.13074959

>>13074798
I want to splatter my cum all over her

>> No.13074967

When you bury a hamster, do you you just drop them in the hole like a seed or do you put them in a hamster sized casket?

>> No.13074968

>>13072812
Stay in small company where the biggest streamer doesn’t even get reimu numbers and your anxiety isolates you, or join niji en where you have at least 2 friends applying already and you will get a number boost because it’s only competition is hololive…hmmm hard choice

>> No.13074992
File: 887 KB, 1198x915, 1632760937149.png [View same] [iqdb] [saucenao] [google]
13074992

>>13074871
>>13074911
SUBMIT TO YOUR UNBIRTHING SESSION Selen

>>13074959
>>13074937
>>13074883
Good pomudachi

>> No.13074996

The psychiatrist from Madness Returns was a cunny fanboi.

>> No.13075002

Anyone who says Fish is a better streamer than Selen is a fucking moron. The numbers back it up your hipster twats.

>> No.13075001
File: 22 KB, 598x194, Bonked lol.png [View same] [iqdb] [saucenao] [google]
13075001

>>13074542
Allergies...also petra finally got bonked trying to jp pander so hard.

>> No.13075004

Selen...

>> No.13075020

>>13074812
I feel like maybe she is trying to not be so flippant about the game. Laughing is like a filler for her in her streams so it feels kind of weirdly empty when she is trying to approach something more sincerely.

>> No.13075021

>>13074967
You put him into biodegradables.

>> No.13075038

>>13074996
So was Lewis Carroll himself

>> No.13075049

>>13074996
Jesas

>> No.13075055

>>13075002
that means gawr gura is the best streamer in the western vtuber sphere, and every holo en is better than every niji en.

>> No.13075059

>>13075020
>I feel like maybe she is trying to not be so flippant about the game
????????????

>> No.13075069

>>13075002
Yeah and baby shark is the best video ever on youtube, the numbers back it up.

>> No.13075077

>>13075055
Literally who

>> No.13075080

>>13074753
Karaoke, Lucius, Super Hot, and Cat Lady are all good intros desu. Her SC reading streams are often gold too, but the best moments from those get clipped usually.

>> No.13075088

>>13075001
I have never understood what the upside would be of having two art tags when she wants you to use both of them anyway.

>> No.13075092
File: 52 KB, 500x501, 1624765254223.jpg [View same] [iqdb] [saucenao] [google]
13075092

>>13075002
>The numbers
Shitstain, the best streamer is the one you love the most. Numbers don't matter.

>> No.13075106

>>13075055
never heard of your indie.

>> No.13075110

Why do we have 8 girls that do the same shit? At least nina and selen are unique.

>> No.13075121

>>13074542
mom is on the corner to the room being supportive

>> No.13075122

>>13075001
Kek, dumbass pengy.

>> No.13075127

>>13074996
Really?

>> No.13075149 [DELETED] 

>having chink parents

https://pastebin.com/EtEFGfvH

>> No.13075150 [SPOILER] 
File: 2.24 MB, 1000x1487, file.png [View same] [iqdb] [saucenao] [google]
13075150

>>13075092
She really is best.

>> No.13075152

>>13074753
I Like her Lucius streams. Her first karaoke is a must as well

>> No.13075171
File: 3.51 MB, 418x383, 1630611147189.gif [View same] [iqdb] [saucenao] [google]
13075171

>pomu milking your cock every morning to use for her facecream
>getting super annoyed with you when it takes too long
>"I have to go to work!"
>being pomu's facecream dispenser

>> No.13075172

>>13073949
... is she retarded? She thinks no one will see that? why the fuck is this girl talking about those kind of things in the open?

>> No.13075193

>>13075121
Speaking of mom I know people hate hololive here but I really loved when Pekora brought her mom on stream. I hope Selen will also do the same seeing how close they are.

>> No.13075199

>>13075172
Yeah, she is going to get fired soon. Flips on suicide watch.

>> No.13075203

>>13075150
where the fuck are her headwings??

>> No.13075207
File: 80 KB, 1143x1308, 1624735271625.jpg [View same] [iqdb] [saucenao] [google]
13075207

>>13075171
This is now one of my fantasies. Thank you pomudachi, you are my greatest ally.

>> No.13075208

>>13075172
She's trying to pull a noraneko

>> No.13075209

Pomy needs to graduate for her mental health, she's getting crazier every stream

>> No.13075217

>>13075001
Ah yes, bonked. That makes so much sense.

>> No.13075219

>>13075193
You are really starting to annoy me with this shit.

>> No.13075239
File: 332 KB, 400x432, 1623866834615.png [View same] [iqdb] [saucenao] [google]
13075239

>>13075171
That's hot af wtf

>> No.13075238

>>13075193
Rather see Pomumama and Pomu’s Grandmother. Couldnt get more based.

>> No.13075241

>>13075193
kys

>> No.13075242

>>13073949
selen said that all of nijien is under 1 manager.

>> No.13075261

>>13074657
>black people had their own schools, theaters, festivals, and boats but not their own swimming pools
>the entire east coast ocean is guarded by whites
>what are rivers and lakes
White people are not responsible for Niggers inability to swim. I really hope you weren't trying to "gotcha" me with that nonsense.

>> No.13075335

>>13075219
I have no idea what you are talking about but you sound very negative and immature. This is a place for positive discussion about nijisanjiEN livers. Negativity is not allowed and bannable so please rethink your childish attitude.

>> No.13075361

>>13075171
jesus
thats so hot
I also have a fantasy of fucking her while shes working (streaming) because she wants to save time

>> No.13075390

>>13075171
Lesbians don't have dicks to dispense cum from. I hate unrealistic fanfics.

>> No.13075401

>13075335
you are trying to hard, same bait as yesterday. Get new material already

>> No.13075402
File: 190 KB, 1170x1611, FEALFAcWUAA0-cp.jpg [View same] [iqdb] [saucenao] [google]
13075402

>>13075171

>> No.13075426 [DELETED] 

>>13075149
This reads like one of those unrelated attention-seeking posts you occasionally see in Youtube comment sections.

>> No.13075446

>>13075127
I actually remembered it wrong. Alice's sister wasn't a kid. But the psychiatrist is a rapist and probably diddled any kids he was "treating". That guy is extremely fucked up.

>> No.13075487

>>13075401
It shows how retarded this place is. Not to mention you are pretty mad bro.

>> No.13075497
File: 65 KB, 250x250, 1627440373920.png [View same] [iqdb] [saucenao] [google]
13075497

>>13075446

>> No.13075508

I really really don't understand the mindset those girls have to talk about that shit in public. Don't they know that talking like this only makes things worse for them and for their own branch?

>> No.13075520
File: 13 KB, 244x312, dfasdasfasf.jpg [View same] [iqdb] [saucenao] [google]
13075520

Wait, so do >we like Nina now? I've been out of te loop, what made you tards change your mind? Last I've checked you were foaming at the mouth about her being the final yab or something retarded like that.

>> No.13075522
File: 610 KB, 900x631, Selen ogey.png [View same] [iqdb] [saucenao] [google]
13075522

>>13075446
wtf

>> No.13075530 [DELETED] 

>>13075149
I don't blame her, my parents where controlling/abusive too and I don't talk to them much any more. When your response to getting C's in school is to starve and beat your son I don't think you deserve much after they can legally be free

>> No.13075536

>>13075508
They are dumb anon, and don't have experience with corpos or being in big groups.
Also their very dumb.

>> No.13075547

>>13075520
you're thinking of /pol/obronies

>> No.13075548

>>13075520

Watch streams

>> No.13075555
File: 866 KB, 2480x3508, 1629745832078.jpg [View same] [iqdb] [saucenao] [google]
13075555

>>13075171
Girls do not like smelling like fish.


Except Finana.

>> No.13075560

Did anyone post Petra schedule?
https://twitter.com/Petra_Gurin/status/1460277218018422792?s=20

>> No.13075563

>>13075193
Where the fuck is the Jay poster to autistically scream to these holoniggers?

>> No.13075564

>>13075520
no, she is still a bad streamer because of the cringe persona

>> No.13075565

So when did nijiEN give up on being seiso and family friendly?

>> No.13075567

>>13075520
>we
This general has never had that feeling. Thats the board not the general.

>> No.13075570

>>13075536
Exactly. They don't appreciate that they are a part of a family now. And you never air shit like that in public about your family.

>> No.13075572

holy shit millie just broke

>> No.13075580

>>13075520
She hasn't been political so I don't care, shes actually a good streamer. Again this will change if she does anything political

>> No.13075587

>>13075565
They never were. Finana was in the debut wave.

>> No.13075591

>>13075508
>hire your employee's friends
>they start shittalking your company real hard in public
kek, serves them right

>> No.13075596

>>13075520
I liked her after she stopped saying honey every second and her game choices are pretty good. She gets along with everyone in NijiEN pretty well, I saw her endurance stream with Pomu and Millie

>> No.13075601

>>13075560
Someone did, also some anons made fun of her for the baby shit for her next SC reading.

>> No.13075602

>>13075520
Turned a new leaf left her past behind.

>> No.13075603 [DELETED] 

>>13075149
And then they gave her a 3080 and everything was fine, as if this wasn't exaggerated nonsense in the first place.

>> No.13075605

>>13075565
When Lazulight debuted.

>> No.13075607

>>13075520
She grows on you. I didn't hate her but wasn't feeling on debut, but she ended up turning herself around and its fun to hear her casually talk about games and some of their mechanics.

>> No.13075623

>>13075446
Yep, the guy was a straight paedo who brainwashed young girls into being being sold as sex slaves at the fat lady's brothel. And when the parents of his victims would catch up on his shady shit he would straight up murder them and get the girl all to himself, thats what happened to Alice's family. Man, McGee is a fucked up guy.

>> No.13075626
File: 1.53 MB, 1030x904, 1627073094464.png [View same] [iqdb] [saucenao] [google]
13075626

>13075591
>seething this hard because she didn't get in
Sister... not like this...

>> No.13075639

>>13075565
A while after Lazu's debut,

>> No.13075641

>>13075565
When the company itself was made, there is no seiso in Nijisanji and there has never been. Aside from Sister Claire.

>> No.13075648 [DELETED] 

>>13075603
One of the requirements to be a dragon in nijisanji is to be a huge liar

see any eLIEra stream

>> No.13075649

>>13075520
The only good thing about Nina is that she made Petra part of nijiEN.

>> No.13075654
File: 241 KB, 1804x1566, 1627263249370.jpg [View same] [iqdb] [saucenao] [google]
13075654

Waiting Rooms for Lazulight are up:

Pomu= https://www.youtube.com/watch?v=n5ErVRZZaiI

Elira= https://www.youtube.com/watch?v=RrXRwnnCe3w

Finana= still waiting

>> No.13075664 [DELETED] 

>>13075149
I'm confused, who wrote this? Selen?

>> No.13075669

>>13075601
Petra's description for that stream is "I hope I don't annoy myself to death first"
I don't think the baby talk is going to last long

>> No.13075678

>>13075591
Flans, drop it you losers.

>> No.13075687

>>13075001
bonked by herself, past petra made her life annoying lol

>> No.13075698

>>13075261
go away /pol/

>> No.13075703

>>13075208
based, love the retarded cat

>> No.13075704

>>13075591
What do you think Pomu and Elira were?

>> No.13075706

>>13075520
She gets along with all of the NijiEN girls despite dramafags claiming otherwise like they do with everyone else's relationships. She's been vouched for by many of them including my oshi. She's had some entertaining and fun streams. She's been pushing less of the honey stuff, not saying it as much as she did on debut, as she's gotten more comfortable in front of a larger audience. It's almost like all of the streamers should be given time to solidify their personas and content? We see this even goddamn wave.

>> No.13075709

>>13075520
she's comfy and streams in the mornings! i like that she explains things because i don't really play videogames

>> No.13075711

>>13075520
nah I still hate nina with the intensity of 1000 suns.

>> No.13075718

>>13075654
Finana
https://www.youtube.com/watch?v=OTZ5CzWTq6s

>> No.13075725 [DELETED] 

>>13075149
Why did someone put it on pastebin when it is still out there on the internet?

>> No.13075728

>>13075565
Finana and Pomu on her own debuts talked about how much they loved hentai. The feesh even outright said that she pirates ir on the daily. They were never FF

>> No.13075734

That's pic really activated the Flip in Millie

>> No.13075740

>>13075623
McGee had a fucked up childhood in general, his mom straight up abandoned him and left him to fend for himself. It's why he looks back on id and even EA fondly, they didn't treat him as shit as his mother did.

>> No.13075741

Millie is having so much fun this stream aahahaha this is actually classic

>> No.13075754 [DELETED] 

>>13075648
You try way too hard to fit in, stop trying to push this and get new material

>> No.13075762

>>13075560
>Arknights
huh, she she trying to find the gacha that'll make her incline like fish with honkai? she just did project sekai recently too

>> No.13075765

>>13075704
hired at the same time

>> No.13075769

>>13075565
Day 1. It's only their designs that are seiso

>> No.13075770

Why did millie had to talk about all of that shit. Now I'm worried about this.

>> No.13075783

>>13075520
my position is still the same, as long as she doesn't produce a yab she; s okay but I only really watch her in collabs so...

>> No.13075784

>>13075520
Watch her Getting Over It stream, It was Kino especially the part where Millie and Pomu joined.

>> No.13075785

>>13075718
wtf Susan where the fuck is that.

>> No.13075797 [DELETED] 
File: 1001 KB, 2481x3507, 1627510090330.jpg [View same] [iqdb] [saucenao] [google]
13075797

>>13075149
>There's so many stories I can tell of the messed up things they do while they're here such as how my mom loves to hit my dog because to her, "it's fun".

>> No.13075796

>>13075728
I swear they actively tried to censor themselves in the beginning but now they're constantly swearing and talking about sex

>> No.13075808

>>13075765
and both were friends..

>> No.13075818

>>13075770
All according to plan then.

>> No.13075838

>>13075741
she had a lot of fun during the collab with Oliver, Layla and Siska too. She just needs to stop sabotaging herself

>> No.13075856 [DELETED] 

>>13075603
of course they gave the 3080, when you starting losing the emotional control you need to show you "changed" and its gonna be different from now on.
Also is hard to really want to complete cut off the ones you lived together all your life so they will accept any pathetic attempt of showing remorse

>> No.13075866

>>13075565
Watch Rosemi-sama!

>> No.13075873

>>13075796
I've never felt that, Finana is still the same horny retard she was in her debut and Pomu only got more and more into her wagie rage.

>> No.13075884

insurance started in 1750....

>> No.13075895

The manager situation was inevitable. As the branch grows and we get more staff/managers it's bound to get some bad apples. We really got lucky before to be honest.

>> No.13075908

>>13075796
its inevitable, you either coomerpost or recline, your choice

>> No.13075913

>>13075818
what plan? I'm not going to donate to her because of that

>> No.13075916

>>13075796
Anon, I will remind you that the whole egg debacle happened on Finana's second week of streaming.

>> No.13075915

>>13073269
Funny enough between beating Cuphead and her fps skills Rosemi is actually one of the better gamers in NijiEN...which feels weird to say.

>> No.13075928 [DELETED] 

Millie, please think about Enna... she'll be sad if you leave her alone...

>> No.13075955

>>13075895
I wonder if she meant staff instead of manager because according to Selen they all only have one manager.

>> No.13075958

>>13075915
she has a streamer brain and reads the chat every 2 seconds. When she focuses on the game, she performs really well

>> No.13075968

Millie has gone full concernfag today eh?

>> No.13075970

>>13075955
that was months ago

>> No.13075990
File: 148 KB, 585x564, 1625263665563.png [View same] [iqdb] [saucenao] [google]
13075990

>>13075740
>>13075623
https://en.wikipedia.org/wiki/American_McGee
Damn, the guy sure suffered

>> No.13075997

>>13073269
Tell her to first beat Finana in GG Strive

>> No.13076004
File: 231 KB, 1120x1792, Selen Chao.jpg [View same] [iqdb] [saucenao] [google]
13076004

Sonic stream onegai

>> No.13076005

Is someone isnt even watching Millie's stream spamming concern on cooldown or something?

>> No.13076024

>>13075970
No that was when ethyria debuted already

>> No.13076035

chances of this going unarchived?

>> No.13076041

>>13074798
Only thing entering your vagina is my DICK

>> No.13076074

Millie does it for free

>> No.13076075

>>13075796
Meanwhile during Pomu's very first video: https://youtu.be/x8Z1IQj3BIc?t=130

>> No.13076089

>>13076005
don't project threadwatcher, these are all the things she said this stream

>> No.13076096 [DELETED] 

>>13075725
hes making it the easier as possible for people to find it and keep the drama floating

>> No.13076097

>>13075916
Nah, the egg thing was way later like the second month of them streaming
https://www.youtube.com/watch?v=iqEJxdHydaE

>> No.13076108

>>13074606
>ASMR
YES
>Everhood
YES
Rosebuds are eating good this week. I never expected my two favorite EN chuubas would play Everhood. I can't wait.

>> No.13076119
File: 146 KB, 435x275, lazylight.png [View same] [iqdb] [saucenao] [google]
13076119

>Can I copy your homework?
>Okay. But don't make it too obvious.

>> No.13076124

Not going to lie that retarded cat pic is pretty good

>> No.13076154

>>13076119
Nice YouTube comment, bro. Upvoted.

>> No.13076155 [DELETED] 

>>13075149
AAAAAAAAAAA I NEED TO SAVEEEEEEEEEEEEEEEEEEEEEE

>> No.13076163

>>13076119
Pomu didn't have time so I'll let it slide this time

>> No.13076162

Selen's Doll PTSD

>> No.13076180

>>13076119
Pomu didnt put Anniversary on the thumbnail
what did she means with that?

>> No.13076191

>>13076005
I just woke up so im seeing that stuff now. I love EN, so when I hear that a retard talk for minutes about hate maro, about graduating, about nijisanji regreting to hire her and about disliking a manager, you would think I would be at least a little concerned about it, no?

>> No.13076226 [DELETED] 

>>13075149
I'll never understand how people let things get to this point, I understand some stuff, but others like straight up emptying your bank account and getting you in debt I don't get, shit like this shouldn't be possible without your direct input

>> No.13076237

>>13075958
On one hand, I do wish she'd focus more on the game sometimes.
On the other hand, the fact that she loves interacting with rosebuds so much that she can't look away from chat is incredibly endearing and makes me love her more.

>> No.13076246 [DELETED] 

>>13076226
She's lying

>> No.13076253

>>13076191
don't take the thread version of her words at face value

>> No.13076272
File: 212 KB, 2456x1033, FEQwqN6WYAchXWS.jpg [View same] [iqdb] [saucenao] [google]
13076272

>> No.13076302 [DELETED] 

>>13076226
alot of fucked up shit can be done just by saying "we are their parents" anon

>> No.13076312

>>13073455
Fish is. Selens got better gameplay random tangents and taste but finanas somehow genuinely seems to get into what shes playing. If your there for the game fish is better.

>> No.13076338

>>13075698
lmao not even him but get schooled

>> No.13076355
File: 209 KB, 443x391, 1628641075687.png [View same] [iqdb] [saucenao] [google]
13076355

>>13074868
>tfw you'll never be fertilizer for Rosemi

>> No.13076358 [DELETED] 

>>13076226
>he doesn't know about narcissists asian families

>> No.13076376 [DELETED] 

>>13076226
>asian parents
There's your answer

>> No.13076408 [DELETED] 

>>13076096
>drama floating
This is retarded. Everyone can watch Selen's streams to see how close she is with her family. That is just some anti bullshit.

>> No.13076424

>>13076253
>don't take the thread version of her words at face value
I swear this should be pinned at the top of the thread in bold letters. Shitposters will always twist a chuuba's words to fit their schizo narratives, like the ones twisting Elira's words to push the "Elira is a liar" bullshit last night.

>> No.13076427

yes, Selen, that's what games do...

>> No.13076431

>>13073455
The only thing Selen has over Finana is that she can play some games at a higher level. Otherwise, Finana's a much, much better entertainer.

>> No.13076435 [DELETED] 

>>13076302
I'm pretty sure that would be highly illegal here

>> No.13076471
File: 46 KB, 275x337, 1612920683332.jpg [View same] [iqdb] [saucenao] [google]
13076471

>reverse psychology
Don't reply, don't get baited.

>> No.13076478 [DELETED] 

>>13076408
https://web.archive.org/web/20201113055556/https://www.twitlonger.com/show/n_1srfgm0
>anti bullshit
?????????????

>> No.13076477

>>13076253
Ok, I'll wait for her vod to be done then for me to hear it and then I'll cast the judgement.

>> No.13076480

>British words

>> No.13076486 [DELETED] 
File: 873 KB, 1083x547, 1630721023624.png [View same] [iqdb] [saucenao] [google]
13076486

>>13076424

>> No.13076489 [DELETED] 

>>13076408
holy cope
also that just means she gave up on trying to fight their antics

>> No.13076497 [DELETED] 

>>13076478
FUCKING RETARD

>> No.13076502
File: 646 KB, 3307x2339, 1634098549246.jpg [View same] [iqdb] [saucenao] [google]
13076502

No Enna today...

>> No.13076507

>>13076237
I wouldn't mind her focusing on the game a bit more too especially if it's lore heavy and she's visibly enjoying it. Hope she takes her time with Dark Souls, as a big fantasy nerd the game should suck her in. It would be nice to see more quiet rose enjoying the game and then talking about it with the chat.

>> No.13076522 [DELETED] 

>>13076408
kill yourself
>>13076478
retard

>> No.13076527

>>13076471
Too late. A retard got baited. I hate this thread sometimes...

>> No.13076528

>>13076119
I thought pomu hated finana

>> No.13076529 [DELETED] 

>>13075603
Just because they give you stuff doesn't automatically make the traumatic shit or the bad times go away.

>> No.13076531 [DELETED] 

>>13076478
imagine being this autistic lol

>> No.13076536

I can do it, I can save her.

>> No.13076541 [DELETED] 

>>13076489
>>13076478
Fuck off antis. Go back to your discord. This isn't the place for antis.

>> No.13076571 [DELETED] 

>>13076541
I like your baiting style, man. Works on VSJ+ like a charm too

>> No.13076576

>>13076527
Sometimes I feel like they reply to themselves only to make me seethe. People can't be this dumb, right?

>> No.13076587 [DELETED] 

>>13076408
>That is just some anti bullshit
how the family is doing right now we can only assume if her positivity is genuine or not
Even though the twitlonger was sadly real, this is a only on /here/ drama and have not affected her streams

>> No.13076591

>>13076536
She's already saved by nijisanji.

>> No.13076592
File: 2.15 MB, 2848x4096, realistic_artstyle_Enna_Alouette.jpg [View same] [iqdb] [saucenao] [google]
13076592

>>13076502
I miss Enna too...

>> No.13076612

>>13076180
it's not a celebration to her

>> No.13076624

>>13076592
>realistic artstyle
>real=ugly

>> No.13076632

>>13076612
Says Celebration in the title though

>> No.13076633
File: 1.50 MB, 2064x2914, 1627678252050.jpg [View same] [iqdb] [saucenao] [google]
13076633

>> No.13076635

>>13076536
who? there is like 4 girls in need of saving in EN now

>> No.13076641 [DELETED] 

>>13076587
>the twitlonger was sadly real
Oh fuck off faggot. You schizos think everything someone writes here or on the internet is real.

>> No.13076652

>>13076507
Same actually. Rosemi getting into the lore and gradually mastering the gameplay would be amazing to watch. Unfortunately she still has the hangup about being too quiet during streams so I don't know how immersed she'll be able to get.
It'd probably take a boss beating her ass repeatedly for her to completely focus on the game.

>> No.13076663

>>13076635
yeah, and they are
pomu
pomu
pomu
pomu

>> No.13076696
File: 297 KB, 1240x1754, 1615356260561.jpg [View same] [iqdb] [saucenao] [google]
13076696

I love Elira! She's so lovable and cute!

>> No.13076724 [DELETED] 

>>13075149
God, I wish I had a cute GF with helicopter parents that just wants to live a free life where she can be a degenerate as much as she wants.

>> No.13076736

So who's the most SC'd in NijiEN right now? Is it Selen or Pomu

>> No.13076747 [DELETED] 

>>13076641
>You schizos think everything someone writes here or on the internet is real.
It seems you're on a copium chamber right now, at least it keeps you happy

>> No.13076749

>>13076663
everyone in EN is Pomu so you're not wrong

>> No.13076760
File: 919 KB, 4092x2893, Elira Cute.jpg [View same] [iqdb] [saucenao] [google]
13076760

>>13076696
I love her as well, she's so sweet and bubbly and I want to marry her!

>> No.13076765 [DELETED] 

>>13076641
>I-its a lie
fuck off retard, she had a lot of problems in the past to this to be false

>> No.13076779
File: 136 KB, 1061x1178, 1635827333358.jpg [View same] [iqdb] [saucenao] [google]
13076779

Reimu LOVE! I miss her...

>> No.13076780

Selen getting lost when there are literally directions on the walls.

>> No.13076788

>>13076736
Check Playboard yourself

>> No.13076792

>>13076736
Pretty sure it's Pomu

>> No.13076796

>>13076576
It's hard to tell. In the early days of the thread, samefagging was significantly less rampant so it was easy to pick out the shitposters. Now that we have obsessive schizos that will go to the trouble of falseflagging as other fanbases for multiple threads, this very well could just be a samefag.

>> No.13076801

>>13076736
Pretty sure it's fuck off and never come back.

>> No.13076819

>>13076592
this looks like it was made by someone who has only seen recreations of classical paintings but no real classical paintings. it looks like the imitation of an imitation

>> No.13076835 [DELETED] 

>>13076765
>>13076747
Anti scum like you deserve the rope. Not to mention it is enough to watch one or two of Selen's streams to see that this is fucking bullshit.

>> No.13076873

>>13076576
It definitely happens.

>> No.13076875

>>13076819
all classical paintings are recreations, anon. Restoration effort is a bitch and been done hundreds of times.

>> No.13076887
File: 181 KB, 400x400, FriendCopium.png [View same] [iqdb] [saucenao] [google]
13076887

>13076835
And i watched every Selen stream
now kys

>> No.13076891 [DELETED] 

>>13076835
Optimism is a good thing, keep it up

>> No.13076901

>>13076873
I'm pretty sure it happened just now.

>> No.13076905

We now only need something from Petra so obsydia will be 100% people with shitty parents

>> No.13076908

>>13076253
I'm watching it live and she definitely said she dislikes one of her managers but it might've been her ESL brain talking about one of her past managers or trying to crack a joke idk.
The other stuff is just her sharing her feelings and not really drama.

She also said she wants to open membership when she hits 100k just to give everyone emotes so famillie can look forward to that I guess if she's not fired first.

>> No.13076917
File: 284 KB, 747x906, thought.png [View same] [iqdb] [saucenao] [google]
13076917

yo.

>> No.13076923

>>13076796
>Everyone who disagrees with me is just one schizo
This is what an actual schizo thinks.

>> No.13076948

>>13076917
Tits look a bit weird. Maybe remove them.

>> No.13076958

>>13076592
horrible
>>13076917
now this is art

>> No.13076962

>>13076163
Finana uploaded hers after Pomu though.
Maybe she made it for Pomu and spent extra time changing hers so they're not identical I guess.

>> No.13076965

Why is it that Hana can have a spoiler free chat because she actively tard wrangles those who spoil but Millie does the same thing and dinguses still can't help themselves

>> No.13076976
File: 522 KB, 900x833, petoracry.png [View same] [iqdb] [saucenao] [google]
13076976

Man what the fuck is that twitlong from selen. That's so abusive and shitty. I really pity selen in this situation, it really sucks.
>>13076905
Pentomo here, from what she said about her parents, they seem to be in a good relationship and good parents.

>> No.13076984

Any guesses as to what the Lazulight collab game is going to be?
Finana put this hint in her description:
-

>> No.13076987

>>13076917
don't ruin rosemi with cowtits

>> No.13076992

>>13076965
she doesn't do it hard enough, she's too soft

>> No.13077008

>>13076923
And this right here is another schizo strategy of quoting something I never said to create a strawman. You gotta try better than that my man.

>> No.13077010
File: 8 KB, 603x91, hint.png [View same] [iqdb] [saucenao] [google]
13077010

>>13076984
Well that didn't copy correctly

>> No.13077019

>>13076965
A bunch of people hate Hana for that tho, I love her but I wouldn't expect most livers to treat their chats like she does

>> No.13077021
File: 176 KB, 1920x1080, FEP2B-2acAA4X1k.jpg [View same] [iqdb] [saucenao] [google]
13077021

petra looks like a diaper-filling baby in her new thumbnail

>> No.13077023

>>13076905
easy she just needs to drop out of school

>> No.13077024

>>13076962
I bet Petra made both, I love my design slave of NijiEN

>> No.13077035

>>13076976
>Pentomo here, from what she said about her parents, they seem to be in a good relationship and good parents.
I mean, it seemed that way with Selen as well, until someone dug up that twitlonger

>> No.13077045

>>13076696
Eleerie.png

>> No.13077053

>>13077010
That's a long title

>> No.13077064

>>13076917
theyre not even lactating and she is not pregnant

>> No.13077070

>>13076917
why isnt she pregnant with buta triplets yet?

>> No.13077076
File: 98 KB, 358x392, 1517989634331.jpg [View same] [iqdb] [saucenao] [google]
13077076

Selen...

>> No.13077118

>>13076965
Hana had to tardwrangle her chat a lot to get it to this point.
Unfortunately, from what I have seen Millie is too soft to pull of what Hana does. With "that" kind of audience you need to be strict.

>> No.13077121

>>13074606
>Astronomy learning
What does it meeeeeeeeeeeeeeeeeeeeaaaaaaaaaaaaaaaannnnnnnnnnn?

>> No.13077124

>>13077076
I'll never be able to hear her laughter again without thinking of the pain behind it

>> No.13077152

>>13076984
Anyone else hoping they drop the game halfway through and it just turns into a zatsu?

>> No.13077157
File: 469 KB, 673x674, Selen Gosling.png [View same] [iqdb] [saucenao] [google]
13077157

>>13077124

>> No.13077179

>>13077121
were gonna nerd out bro

>> No.13077182

>>13076905
So they are the dark counter part of lazu not because "edgy" but cause all of them have a dark&sad origin

>> No.13077186

that whole Selen mom is bad rumour spreading is pretty low. like you can't find anything bad about Selen so you go after her mom?

>> No.13077189
File: 207 KB, 1143x1884, Selen.jpg [View same] [iqdb] [saucenao] [google]
13077189

Guys...how about we talk about Selen's stream instead of whatever dumb shit is going on in the thread?

>> No.13077192

>>13077118
Well that's a good point, 2 years is a pretty big difference to understand the streamers' intentions and preferences. Don't want to throw more stress on boss but if Millie wanted some advice on how do it a little better maybe she could ask

>> No.13077205
File: 449 KB, 800x800, 1634790248164.png [View same] [iqdb] [saucenao] [google]
13077205

If that pastebin is real Selen's final goal is to go dark so her parents can't find her, and presumably all you dragoons too...

>> No.13077233
File: 290 KB, 347x391, 1624765248909.png [View same] [iqdb] [saucenao] [google]
13077233

>You have to wait a while before [REDACTED] another post.

>> No.13077260

Millie is such a troll...

>> No.13077265

Stop talking about doxx shit, imagine how Selen would feel seeing you fuckers arguing about her past and building this pitiful caricature of her in your heads.

>> No.13077277

>>13077070
>>13077064
soon anons I promise

>> No.13077289 [DELETED] 

>>13075149
This is past life doxx stuff technically

>> No.13077294

>>13077189
the only thing on stream on this topic was that her mom brought her water even though her stream was starting. if anything she feels overprotective. that is why I can't stand faggots and their lies in this thread.

>> No.13077313 [DELETED] 
File: 291 KB, 1585x1155, 1634840032416.jpg [View same] [iqdb] [saucenao] [google]
13077313

UOOOOOOOOOOH CUUUUUUNNYYYYYY
ToT

>> No.13077337

>>13077313
pleasure knowing you nigga

>> No.13077350 [DELETED] 
File: 1.18 MB, 975x1223, unknown.png [View same] [iqdb] [saucenao] [google]
13077350

>muh abusive family
Sounds more like a coddled baby who didn't get her way

>> No.13077357

>>13077313
uuuoooooh

>> No.13077359

>>13077035
My copium is after the twitlonger they finally understand how destructive they are returned to HK for a time and slowly changed and healed their relationship since last year, finally getting to today situation where wherever she talks about them is pure a happiness and comfy to listen to

>> No.13077386

>>13076917
Nice. Love Brosemi and those pectorals.

>> No.13077393 [DELETED] 

>>13077350
>giving gifts = love
wow anon i feel sorry for you

>> No.13077401 [DELETED] 

>>13077350
wtf i had to pay up nearly 1500 dollaridoos for mine
privileged bitch

>> No.13077402 [DELETED] 
File: 269 KB, 1448x2048, 1633607954525.jpg [View same] [iqdb] [saucenao] [google]
13077402

SEX

>> No.13077404

>>13075520
she won over the slavs frenchies and gamers with her streams over the period of about a week

>> No.13077419

Is this the beginning of the Millie voice changer arc?

>> No.13077422

>>13077402
>big tits
absolutely ruined

>> No.13077433

>>13077402
>>13077313
ABAYO

>> No.13077441 [DELETED] 

>>13077350
>a politician gave me money! That's mean he cares about me!
retard

>> No.13077444 [DELETED] 
File: 479 KB, 2006x2833, xrnd7m.jpg [View same] [iqdb] [saucenao] [google]
13077444

>> No.13077442
File: 160 KB, 718x620, FDr0OTRXMAETM4J.png [View same] [iqdb] [saucenao] [google]
13077442

>> No.13077457
File: 150 KB, 500x500, 1635347292722.png [View same] [iqdb] [saucenao] [google]
13077457

>>13077402
WHAT THE FUCK IS THAT ON HER CHEST

>> No.13077473 [DELETED] 

>>13077401
1500 dollars? You should be able to get one for only 700 bucks if you look hard enough.

>> No.13077480
File: 14 KB, 832x876, 1633116166996.png [View same] [iqdb] [saucenao] [google]
13077480

This thread right now

>> No.13077484 [DELETED] 
File: 730 KB, 2555x3300, E-HzBPMWEAYiDp7.jpg [View same] [iqdb] [saucenao] [google]
13077484

MILK

>> No.13077502

>>13076962
Apparently they just share the same braincell
https://twitter.com/FinanaRyugu/status/1460346368594223108

>> No.13077509

>>13077444
based

>> No.13077533 [DELETED] 
File: 349 KB, 2376x1533, 20211107_214002.jpg [View same] [iqdb] [saucenao] [google]
13077533

I'M GONNA POOOOM
AAAAAAAAAAAARGH
I'M GONNA POOOM BABY AAAAAAAAARGH

>> No.13077548

>>13077313
based

>> No.13077556

Stop sexualizing Pomu.

>> No.13077560

got any eliras?

>> No.13077562 [DELETED] 

>>13077350
4 months after twitlonger
brought on hong kong
>so they moved out and left her alone, yay
only get to put her hands on the 3080 after they "visit" in canada
>they now live in canada

the cycle repeats

>> No.13077563

>>13076984
>>13077010
Final Fanta 14

>> No.13077566

At least post futa if you are such a faggot.

>> No.13077568

>>13076905
Does rosemi have shitty parents?

>> No.13077569

you got any petra ones ascended slutposter?>>13077484

>> No.13077580 [DELETED] 
File: 421 KB, 2276x1368, E7FIjrNXMAMFBcs.jpg [View same] [iqdb] [saucenao] [google]
13077580

J-BOY I JUST POOMED MY PANTS COME CLEAN IT UP I'LL GIVE YOU A HOT POCKET

>> No.13077596

>>13077568
No her parents are very protective and saved her from getting screwed over by Tsunderia.

>> No.13077601

>>13077502
I thought Finana and Pomu weren't talking to each other? I guess they made up

>> No.13077602

>>13077568
depends on your views about overly protective parents

>> No.13077606

>>13077556
Do the opposite of this.

>> No.13077617

>>13077568
Her mother is manipulative and controlling but her dad is cool

>> No.13077625
File: 164 KB, 756x1181, Elira!.jpg [View same] [iqdb] [saucenao] [google]
13077625

These faggot artists need to draw more Elira, she's objectively the hottest

>> No.13077626

>>13077563
>Final Fanta 14
May be possible if Finana is having the two of them just going through the character creator.

>> No.13077631
File: 252 KB, 664x618, 1635303636268.jpg [View same] [iqdb] [saucenao] [google]
13077631

Marvelous work, anon

>> No.13077634

>>13077568
They sound a little overly protective, but its hard to really tell family dynamics from a handful of stream anecdotes.

>> No.13077637 [DELETED] 

>>13077350
Imagine concernfagging over a 2 year old twitlonger.
Couldn't be me.

>> No.13077653

>>13077404
get the french slice, get the russian slice
play actual games instead of shitty horror games

dare I say the other 3 really messed up they own growth

>> No.13077656
File: 3.64 MB, 1593x1390, EN corpos smaller.png [View same] [iqdb] [saucenao] [google]
13077656

You guys like fightan

>> No.13077661

>>13077596
i can't believe rosemi's parents beat up slugma...

>> No.13077675

>>13076965
Hana also has at least one active mod to help her. It often feels like EN doesn't have anyone besides themselves.

>> No.13077677

Dragon brain...

>> No.13077683 [DELETED] 
File: 1.12 MB, 1602x899, ck4oz4.png [View same] [iqdb] [saucenao] [google]
13077683

COME CLEAN MY COCK MEIDO

>> No.13077691

FUCK I'M HORNY NOW FUCK YOU MOTHERFUCKERS I'LL BE BACK IN A BIT AND THIS SHIT BETTER STOP BY THEN I FUCKING HATE YOU

>> No.13077698

>>13077568
Retards here believe Elira has shitty parents just because they're normalfags. So by that standard yes

>> No.13077718

>>13077691
it's a good thing i have very specific fetishes and don't get hard to anything else
no amount of porn posting will do this to me

>> No.13077727
File: 94 KB, 480x480, 1634524706860.png [View same] [iqdb] [saucenao] [google]
13077727

Subtly Symbolism

>> No.13077737

>>13077683
The guy should be younger

>> No.13077749

>>13077718
degen anon...

>> No.13077762

>>13077683
BASED BASED BASED

>> No.13077770

>>13077568
Rosemi really likes her parents but her mom seems overprotective and controlling. During her first few weeks Rosemi was really frustrated with her parents due to them visiting her unannounced all the time forcing her to move/delay streams.
They seem to have calmed down now though and she at least loves them enough to go on family outings together.

>> No.13077775

>ywn be a cute shota for elira
why even live

>> No.13077776
File: 424 KB, 1532x2048, 1622488133360.jpg [View same] [iqdb] [saucenao] [google]
13077776

>>13077656
>2nd bottom row
Who?

>> No.13077786 [DELETED] 
File: 3.86 MB, 2549x3541, 91974489_p0.png [View same] [iqdb] [saucenao] [google]
13077786

>> No.13077787
File: 312 KB, 1295x1812, 1632448031553.jpg [View same] [iqdb] [saucenao] [google]
13077787

>>13077625
She needs a lewder outfit to show off her figure, especially if she ever hopes to attract shotas like Noel, Utako, probably even Nui or Rin.

>> No.13077803

wth is going on

>> No.13077806

>>13077718
Same. Unless it's a gender bender JAV where the guy turns into a girl, keeps his dick, gets raped by girls, and then makes out with them I can't get off to it.

>> No.13077815

>>13077656
I do! Wish sc6 had more love in the fgc

>> No.13077817

I WANT TO SHITPOST STOP MAKING ME HORNY AAAA

>> No.13077820

>>13077786
god I want to fuck hada

>> No.13077827

>there were people that thought this thread has its own meido now
Wew

>> No.13077832

>>13077806
...code?

>> No.13077855

>>13077656
i only like 2d anime fightans

>> No.13077859

>>13077806
I should watch more JAV...

>> No.13077866
File: 180 KB, 858x1200, 1633668406599.jpg [View same] [iqdb] [saucenao] [google]
13077866

>>13077787
something's missing

>> No.13077882

>>13077786
>>13077787
Their voices are absolute sex.

>> No.13077886

>>13077866
SONNA

>> No.13077889
File: 81 KB, 948x937, 456456465464.jpg [View same] [iqdb] [saucenao] [google]
13077889

Description
heart's been broke i
hate myself but
it won't show i
constantly lose all
my remorse, and it's

>> No.13077890

>>13077806
code bro

>> No.13077898

Just use the knife Selen...

>> No.13077911
File: 191 KB, 1200x630, 1617954564667.jpg [View same] [iqdb] [saucenao] [google]
13077911

>>13077820
Same

>>13077827
>He just came here to ban the holofag shitposter
That's kinda funny

>> No.13078020
File: 151 KB, 1280x1280, 1634911947800.jpg [View same] [iqdb] [saucenao] [google]
13078020

>Bunch of lewds posted
>Threads slows down
W-what are you guys doing?

>> No.13078024
File: 96 KB, 281x246, noteven1500.png [View same] [iqdb] [saucenao] [google]
13078024

2hours in and not the usual 2k
It is really the time slot or Alice is truly a debuff game?

>> No.13078043

>>13078020
spamming chat while millie was pissing

>> No.13078054
File: 2.91 MB, 568x690, 1636959672373.webm [View same] [iqdb] [saucenao] [google]
13078054

>>13078020

>> No.13078059

>>13078024
i thought you faggots would be fine with anything that isn't apex

>> No.13078078

>>13078024
Uninteresting game + her normal numbers. Lately she's just been spamming a bunch of horror games + Apex which are both big buffs to her.

>> No.13078081

>>13078020
lets just say I only have one hand available right now

>> No.13078125
File: 594 KB, 494x680, 1636776191789.png [View same] [iqdb] [saucenao] [google]
13078125

>>13078020
I was thinking about Pomu's soft hands. Should I buy nylon gloves?

>> No.13078127
File: 389 KB, 1536x2048, 1627250258687.jpg [View same] [iqdb] [saucenao] [google]
13078127

>>13077625
her indifference to lewds really hurts her in that regard.
i agree, she is incredibly hot. her voice, her design, her personality. deadly.

>> No.13078133
File: 664 KB, 640x480, 1635990575769.webm [View same] [iqdb] [saucenao] [google]
13078133

>>13078020

>> No.13078137

Game died...

>> No.13078139
File: 1.41 MB, 1280x720, 1615571637211.webm [View same] [iqdb] [saucenao] [google]
13078139

>>13078020

>> No.13078140

>>13078024
Alice is a niche series, even back in the day. It also happens with multi part playthroughs, they do lose interest after a while.

>> No.13078157

>>13078059
im a pretty content fag as long she's streaming
dont really care about Alice but still weird being so low for a game bunch of other fags say "its amazing"

>> No.13078171

>>13078020
>Everyone is jacking off with me
Hot, let's cum together

>> No.13078176

>>13077886
BANANA...

>> No.13078180

>>13078024
Debuff streamer

>> No.13078188
File: 179 KB, 311x439, pien.png [View same] [iqdb] [saucenao] [google]
13078188

>bora graduation
>no good streams on
>ubereats driver stole my lunch
>employment services canada asking me to repay 2000 leafbucks

This day could not get any worse...

>> No.13078218

>>13078188
don't jinx it with a Rosemi pic aaaaaaaaaaahhh

>> No.13078225

>>13078188
FUCK YOU, LAZULIGHT 6 MONTH CELEBRATION COLLAB STREAM IN 2 HOURS, GET HYYYYYYYYYYYYYYYYYYYYYPED

>> No.13078233
File: 446 KB, 526x596, woseminoodles.png [View same] [iqdb] [saucenao] [google]
13078233

>>13078188
anon....

>> No.13078234
File: 407 KB, 1185x1439, 1632263581689.jpg [View same] [iqdb] [saucenao] [google]
13078234

>>13078188
>no good streams on
I don't pity you.

>> No.13078239

>doxxposters actually successfully distracted by porn
I still dont like slutposters but today youre alright

>> No.13078246
File: 172 KB, 956x894, 1623806715063.jpg [View same] [iqdb] [saucenao] [google]
13078246

>>13078024
>2hours in and not the usual 2k
Alice is niche game plus she made her the 3 Alice streams in 3 different time zones, making difficult to cultivate that audience (and her second stream was +7 hours making difficult to watch the VOD). Her first stream peak at 1800
That's why she didn't get her normal numbers, but still pretty good considering the game
>>13078059
I'm watching her now and i stayed late to watch part 2

>> No.13078247
File: 1016 KB, 1212x588, 1636036069521.png [View same] [iqdb] [saucenao] [google]
13078247

>>13077911
sauce?

>> No.13078251 [DELETED] 

So now with the death of the gook branch, it's gonna be hillarious seeing Elira try to go crawl back into everyone's grace in nijien. She's done it to herself when sdshe decided to isolate herself from the rest of the EN girls.

>> No.13078254

>>13078024
I mentioned it above, but she streamed this game at 4 am ET, 8 pm ET, and 3 pm ET so far. It's completely retarded timing for a story game people are supposed to follow all parts of. I'm amazed 1.3k people are here for this shit rn.

>> No.13078268

>>13078225
Pomu and Finana are going to fight again and it's going to be super awkward.

>> No.13078273

>13078251
Still trying to push this shit, absolutely pathetic

>> No.13078274

>>13078127
Feesh just need to brought up how hot eliras lewds are on their next drunk collab in december
it will start with elira screaming "RIIIIIIIGHT? ITS SO FUCKING GOOD"
them it will awake inspiration on the artists knowing the sweaty stinky dragon actually loves to be lewded

>> No.13078293

>>13078024
It's retarded choice of streaming hours. I've seen 1st part, but 2nd started at 3am and lasted 7 hours. Then literally 12 hours later part 3 started. Even if I somehow go back to that long vod it won't be until weekend

>> No.13078299
File: 36 KB, 423x193, 1636942785096.png [View same] [iqdb] [saucenao] [google]
13078299

>lowest viewership
>lowest superchats
>highest amount of dead subs
Why is Finana such a failure?

>> No.13078320

Seems like burgerkids are home from school

>> No.13078324
File: 384 KB, 419x462, 1636776708611.png [View same] [iqdb] [saucenao] [google]
13078324

>>13078251
>sdshe
lol retard!!!

>> No.13078325

>>13078246
>3 different time zones
What if this was mom's idea?

>> No.13078330

Nijisanji EN sub growth 14/11/21

2.4k: Nina
1.2k: Reimu
1k: Elira, Petra, Finana
700: Millie
600: Enna
500: Selen
333: Rosemi
250: Pomu
https://virtual-youtuber.userlocal.jp/office/nijisanji_world?order=fav_cnt_diff

Nina reached 100k, Finana reached 200k and Reimu got a big boost from her collab with Misora.

>> No.13078332

>>13078320
It's west coast. EST has been home for a while now.

>> No.13078334

>>13078299
>low intelligence
>low test
>highest amount of cocks sucked
why is anon such a faggot?

>> No.13078365
File: 166 KB, 256x258, 1634129046865.png [View same] [iqdb] [saucenao] [google]
13078365

>>13077832
>>13077859
>>13077890
>RCTD-227 for rape
>RCTD-047 for femdom
The POV sections near the end are really fucking good. Second one has a longer POV section with a lot of focus on MC's tits. First one is slower since MC goes around raping and molesting girls as a futa before he's caught and raped in the last 25 minutes by a futa cop and the girl he raped before.

>> No.13078370

>>13078330
I no longer trust this site. Pomu got 1k two days ago, and got another 1k today.

>> No.13078371

>>13078251
KR has similar views with ID even without Bora. They won't go anywhere as a branch.

>> No.13078373

>>13078334
>highest amount of cocks sucked
Yeah, all mine.

>> No.13078378
File: 3.08 MB, 2283x3300, Danbooru_bc60e1347e8e566157ab797568fd0f6c.jpg [View same] [iqdb] [saucenao] [google]
13078378

>>13078133
I don't know what it is about Mito but she always gets me going.

>> No.13078376

>>13078024
dragoonkeks are making excuses, but the reality is that people are finally seeing that Selen has literally nothing going on for her, she's just a generic streamer with an animu avatar without anything she excels at, not even Apex fags are watching her after her Kills Race menhera breakdown.

>> No.13078387

>>13078334
He's a pentomo

>> No.13078433

>>13078370
true... that site is like trusting Susan numbers at the beginning of a stream

>> No.13078456

>>13078325
Selen did the first super late cause she wanted to honor some big supa about alice
The second was a last moment decision and went for 7hours
This third one will be short and shes done with it getting ready for a stress week of collabs and scrims

>> No.13078466

>>13078370
keep seeting fag kek

>> No.13078492

>>13078247
https://files.catbox.moe/44i08k.jpg
https://files.catbox.moe/61bo88.jpg
https://files.catbox.moe/z0h8xp.jpg
Have fun.

>> No.13078512

>>13078376
Based and true, fuck Selen and fuck dragoons

>> No.13078515

>>13078492
cute and hot, thank you

>> No.13078533

>>13078371
Unlike KR, ID is making plenty of money thanks to merch. Meanwhile KR will have nothing going on for them once Bora is out of the picture.

>> No.13078540

>>13078492
>condom
I would cum inside Hada raw

>> No.13078541
File: 530 KB, 750x1050, 1635723215149.png [View same] [iqdb] [saucenao] [google]
13078541

>>13078492
Hot, thanks

>> No.13078549

>>13078492
Hada deserves a bigger ship to dock her port....

>> No.13078554

>>13078370
proof?

>> No.13078568

>>13078533
KR has a bunch of cuties, so fuck off with noombers

>> No.13078580

The mini games aren't that bad in this game

>> No.13078593

>>13078330
>>13078370
I don't trust that site either.
I noticed that it always gives people the 1k growth indicator when their subs move from, say, 142k to 143k, despite them getting the 250, 333, and/or 555 indicators previous times at 142k.
There's rarely, if ever, a move between thousands in the sub count just from the smaller numbers.

>> No.13078594

Speaking of KR, where is that one Kenzocrew that would shill Hada? He was cool.

>> No.13078595

God I want Nina to rape me with her massive slimy dripping cock

>> No.13078597

[Deleted]

>> No.13078596

>>13078568
>KR has a bunch of cuties
So did IN...

>> No.13078609

>>13078596
Noor was the only worthwhile streamer in IN.

>> No.13078611

>>13078533
ID has more going on for them yes, I don't disagree. But KR still seems to be a profitable branch to not be axed. They lost their biggest one but overall their numbers are more than fine.

>> No.13078616

>>13078188
>employment services canada asking me to repay 2000 leafbucks
get dabbed on CERBie

>> No.13078618
File: 22 KB, 112x112, selen.png [View same] [iqdb] [saucenao] [google]
13078618

NOOOO

>> No.13078629

God I want to impregnate Hari Ryu while she bites my neck.

>> No.13078631

>>13078371
>4/6 of the second Wave retire
>3/4 of first Wave retire
>now Bora retires
sure they aren't

>> No.13078633

>>13078554
https://playboard.co/en/channel/UCP4nMSTdwU1KqYWu3UH5DHQ/subscribers
12th: 175k
13th: 176k
15th (now, check her Youtube page): 177k

>> No.13078639

Wait a minute, this game has lots of crashes? dayum and i'm planning to play this

>> No.13078647

Selen...

>> No.13078653

>>13078596
Noor was the only worth in the branch. And uh, their views were below 50. You have a few of those in KR, but there's a lot more that gets an average about 100, 200, 300, 400

>> No.13078673

>>13078653
Views don't matter if they don't bring the money.

>> No.13078674
File: 94 KB, 256x256, Selen Smug.png [View same] [iqdb] [saucenao] [google]
13078674

>[Deleted]
see ya faggot

>> No.13078694

>>13078639
It's a console port from around the time where the PC was an afterthought. Beyond the 31 FPS cap its clear that it was sort of rushed and not given much love, even Crysis 2 from what I hear launched in a rough state despite how famous the first game was for being a PC benchmark.

>> No.13078701

>>13078639
good for baiting though, Selen just got a 500 bucks donation

>> No.13078716

>>13078631
? Second wave are all in Niji KR. If you mean the transferred ones, they are on wave 1.
In any case my point stands, the branch isn't on IN situation at all to get axed.

>> No.13078729

Based pornposter got jannie attention to the thread. This kills the schizo.

>> No.13078739

>>13078673
Let's wait and see then what will happen.

>> No.13078744

>>13078701
>AUD 10.00
???

>> No.13078763

>>13078716
yes I count 541 refugees as Wave 2 because that's what it really is

>> No.13078775

Since we're talking about KR anyways, WHO'S THE FUNNY MAN WHO THOUGHT IT WAS A GOOD IDEA TO HAVE NAGI, NARI, HARI, AND HADA ALL IN THE SAME BRANCH?

>> No.13078778

>>13075990
with a name like that it's not surprising kek

>> No.13078779

>>13078633
Maybe their numbers are delayed anon. I don't know when they update their numbers. Maybe they do in JP times. Let's wait until tomorrow to see if they are going to put 1k for Pomu to see if this theory of mine is true.

>> No.13078797

>>13078609
>>13078653
Vihaan was funny sometimes and Aadaya's ukulele playing was cute... but I still get why they axed the branch. Feels like ID has been actually inclining recently but sadly IN started small and just seemed to get smaller.

>> No.13078800

>>13078775
why

>> No.13078806

wow Millie shitting on Lotta

>> No.13078820

>centaurs don't live in Oxford

>> No.13078823

>>13078763
... but that's not what they are called. Siu, Nagi and Ara are officially called wave 2, while the 541 refugees became part of wave 1.

>> No.13078887
File: 149 KB, 613x484, 1624765310942.jpg [View same] [iqdb] [saucenao] [google]
13078887

>>13078729

>> No.13078889

did the manager tell Millie to saviorbait more or something

>> No.13078896

>>13078775
Based lyricism enjoyer.

>> No.13078902

>>13075520
I hate all of Ethyria from the beginning but now I like Reimu and Nina, don't care about Enna, hate Millie because I sense a two faces personality in her like I feel about hololive's girls and I will become Elira and Pomu's anti if wave 4 turns out to be shit because of their faggot friends

>> No.13078927

>>13078902
>He fell for the nepotism narratives
Oh no, anon, you have brain damage

>> No.13078945

>>13078902
don't rope Elira's friends with Pomu

>> No.13078973

>>13078775
me

>> No.13078998

>>13078775
You know Huey, Dewey, and Lewie, or Gooey, Screwy, and Ratatouille? I guess it's like that, would be fun to see Anykara try to pull that off in the EN branch as a laff.

>> No.13079007

>>13078376
>Kills Race menhera breakdown.
some people are into this shit, not me, not my niche.

>> No.13079042
File: 1.52 MB, 1280x720, RyuucuckNova.png [View same] [iqdb] [saucenao] [google]
13079042

>cucked by her indie friends
>cucked by her nijien friends
>cucked by her nijikr friends
Being Elira is suffering

>> No.13079045

>>13078549
this, art like that always bothers me because i can't imagine myself with a small dick

>> No.13079057

>>13078775
Korean naming at its best
the most creativity they had was not using Park for any chuuba surname

>> No.13079085

>>13078927
I knew it. At least half of this thread unironically believes in the nepotism narratives. You can't help retardation I guess...

>> No.13079099

https://twitter.com/FinanaRyugu/status/1460348098111324160
>horror game
Thanks for ruining what could've been an amazing zatsudan collab you retarded fish

>> No.13079100
File: 165 KB, 480x480, Selen Angry.png [View same] [iqdb] [saucenao] [google]
13079100

The lore is actually fucked up

>> No.13079148
File: 1.26 MB, 850x1200, 1633241609211.png [View same] [iqdb] [saucenao] [google]
13079148

I'm gonna marry this feesh, anons.

>> No.13079155

>>13079099
Elira specified that they'll be chatting, too. It will be part-zatsudan as well.

>> No.13079171

>>13078902
Pomu only got Rosemi in, blame Elira for the shitty picks like the flipshit or the most bland male possible.

>> No.13079190

>>13079171
>>13079085
Like this anon says, you're retarded.

>> No.13079192

>>13078902
oh no anon, you can start preparing your doxx folder and shit
cause wave 4 will only be manlets domesticated by pomu and elira roommates

>> No.13079199

>>13079100
It is. Though sadly the actual gameplay is less than spectacular and the final boss fight is basically just Bongo Bongo's gimmick of "hurt the hands and win".

>> No.13079202

Kill yourself

>> No.13079204

>>13079100
In a weird way I kind of respect that, people talk about how gaems r art but few are actually willing to really push boundaries and see where the line is anymore, like how Rockstar was during the PS2 era with GTA to even Manhunt or Bully.

>> No.13079261
File: 221 KB, 424x424, why-cant-we-just-watch-the-cute-anime-girls-play-games.png [View same] [iqdb] [saucenao] [google]
13079261

>> No.13079267

>>13079199
i will give it a try thanks to Selen... seems interesting and i intent to start from the first game
Yeah, the last boss is... not what i expected
>>13079204
>Bully
Selen wanted to play that, it really fits her

>> No.13079348

>>13079267
Enna would be much better for that game

>> No.13079352
File: 1.06 MB, 1145x645, asdcresdvqaefvwaesdgfvewaqdgvweas.png [View same] [iqdb] [saucenao] [google]
13079352

>> No.13079368

>>13079099
why nijien loves playing horro games so much? why they couldn't play mario party together?

>> No.13079371
File: 1.09 MB, 1140x697, 1628980949669.png [View same] [iqdb] [saucenao] [google]
13079371

>>13079099
Phasmophobia Woooooooooooooooo!!!!!!

>> No.13079379

https://twitter.com/PomuRainpuff/status/1460375457933713408
It's gonna be hillarious to see Pomu absorb all of Finana's gachafags just like she's done with the saviorfags Finana had after her scuffed debut.

>> No.13079393

>>13079379
social darwinism

>> No.13079423
File: 1.05 MB, 1086x1328, E2aMNdUVoAUOrp_.jpg [View same] [iqdb] [saucenao] [google]
13079423

I love my cute feesh wife!

>> No.13079491

>>13079368
Horror games are more fun for the streamer than they are for the viewer.
>why they couldn't play mario party together?
Other EN girls are doing that this week.

>> No.13079501

>>13079379
Pomu wants the yostar sponsorship

>> No.13079523
File: 158 KB, 981x1196, NijiEN Treasure.jpg [View same] [iqdb] [saucenao] [google]
13079523

She finally did it! KINO lore but medium gameplay
i liked it since she got immersed like never before

>> No.13079534

>>13079491
>Other EN girls are doing that this week.
So fucking what? Pomu and Millie are playing Minecraft on the same fucking day this week.

>> No.13079568

>>13078927
I don't believe in neptism shit but the chance of them become a clique inside of nijiEN is more higher as their friend circle grows bigger, some outsider may be ostracized

>> No.13079571
File: 308 KB, 1159x1291, 20211115_174331.jpg [View same] [iqdb] [saucenao] [google]
13079571

I hate this nigga like you wouldn't believe

>> No.13079605

>>13079534
That's so they can collab on MC

>> No.13079613

Millie your deductive abilities...

>> No.13079615

>>13079571
Say hello to your male mave /vt/

>> No.13079617
File: 549 KB, 690x547, 1636862047890.png [View same] [iqdb] [saucenao] [google]
13079617

>>13079571
just end me

>> No.13079619

>>13079534
>So fucking what?
Because typically the EN girls don't like to do the same collab games as the others in the same week.

>> No.13079618

>>13079571
dont know much about buff, did he just get famous from being a cringey reply guy?

>> No.13079639

>>13079571
That is pure envy speaking though you cause girls know who he is and they don't know who you are.

>> No.13079655

>>13079571
They girls probadly like to have more fan like Biff than faggot anons complain in /here/

>> No.13079657

>>13079639
Honestly yeah thats part of it, but the other part is genuine pity for the girls having this guy in your mentions.

>> No.13079666

>>13079639
Why would I be envious of someone they absolutely call a creeper behind the scenes?

>> No.13079673

>>13079639
Put your trip on biff.

>> No.13079675

>>13079379
Pomu didn't stream Priconne so I doubt she'll do it for Blue archive... I hope... I don't want more gacha streamers...

>> No.13079679

>>13079639
>and they don't know who you are.
But Pomu does know who I am and reads my comments in chat all the time. One of perks of being a wisp.

>> No.13079688

Are they announcing their new outfits? The time has come for this, they can no longer postpone it.
Holoen prepares second outfits and 3D

>> No.13079702

>>13079571
I am convinced this is actually a parody at this point.

>> No.13079728

>>13079615
I unironically like to have Biff in wave 4 than Tora, Biff is cringe but he can be cringe kino

>> No.13079730

>>13079571
UNCLE BIFF?

>> No.13079763

Yeah what's up with the uncle part.

>> No.13079798
File: 51 KB, 880x879, 20211115_175042.png [View same] [iqdb] [saucenao] [google]
13079798

>>13079571
He's not done yet

>> No.13079808
File: 1.35 MB, 3507x2481, file.png [View same] [iqdb] [saucenao] [google]
13079808

Violent and rough hatesex with Selen's mom

>> No.13079820

Could we get one, ONE thread without Biff mention? Please?

>> No.13079835

>>13079688
>spoiler
First is delayed indefinitely and 2nd isn't happening until mid-2022 at the earliest.

>> No.13079857

>>13079820
if fag stops selfposting and anons biting his baits

>> No.13079861
File: 111 KB, 166x249, 1623739281368.png [View same] [iqdb] [saucenao] [google]
13079861

>4 months already

>> No.13079862
File: 59 KB, 800x442, tumblr_33caa6fa2d9060d1ebf32b7f13a3bf38_59ae975d_1280.jpg [View same] [iqdb] [saucenao] [google]
13079862

>>13079798
>biff posting these things he made in paint
why can't you just like your oshis tweets or say thanks like everyone else you attentionwhore

>> No.13079865 [DELETED] 

https://pastebin.com/FNvbLswN

Selen...

>> No.13079877

>>13079666
They think everyone who watches them is a creeper looser anyways. Non-loser guys have girlfriends and don't have time to watch vtubers.

>> No.13079898

>>13079835
>First is delayed indefinitely
You mean delayed until NijiEN has some big announcement planned

>> No.13079921

>>13079798
Deep down anons know Biff is a sweet person

>> No.13079944

>>13079921
you can stop posting about yourself anytime schizo

>> No.13079956 [DELETED] 

>>13079865
Dropped. Selen seemed like a nice healthy individual, well not anymore. Don't wanna deal with menheras so I'll just move onto Petra.

>> No.13079958

>>13079798
I feel like he is distilled version of this board. I am sure he hates shitposters and "antis" just like all of you faggots. It is good that you hate yourselves cause you deserve it.

>> No.13079973
File: 369 KB, 906x819, 1634243549976.png [View same] [iqdb] [saucenao] [google]
13079973

>>13079571
>>13079798
>Gossiping about fans on twitter
Nijisisters are pathetic.

>> No.13080002

>>13079798
>>13079571
Biff seems like he's a loyal fan for six months now, I will give him credit for that. At least he's shilling the girls for free unlike anons here

>> No.13080028
File: 755 KB, 890x653, 1626822158497.png [View same] [iqdb] [saucenao] [google]
13080028

>>13079958
What the fuck Biff I never insulted you

>> No.13080035

>>13080002
>>13079973
>>13079958
you can stop posting about yourself anytime schizo

>> No.13080058

>>13079958
Biff pls

>> No.13080070

Uncle Biff?

>> No.13080092
File: 731 KB, 1062x595, 1629946475972.png [View same] [iqdb] [saucenao] [google]
13080092

>> No.13080104

please remind Millie to censor the ending of the case, she is very retarded right now

>> No.13080126
File: 253 KB, 1300x1838, file.jpg [View same] [iqdb] [saucenao] [google]
13080126

I love Rosemi and I can't wait until her ASMR later. That is all.

>> No.13080145

>>13080035
>everyone with different opinion is the same person
lmao, no need to be envious anon, just learn one or two thing from him, support and shilling his oshi for free

>> No.13080148
File: 38 KB, 427x600, disgust.jpg [View same] [iqdb] [saucenao] [google]
13080148

>>13079921
>>13079958
>>13080002
kys

>> No.13080152

>>13080104
>right now

>> No.13080157

>>13079523
I was a little worried she might drop it mid-way. Madness Returns has a good story and solid visual design, but it spreads it very thin with filler platforming sections, set pieces floating out in the middle of empty nowhere, sometimes with nothing else to look at but the skybox. The devs didn't have the time to create any of the planned boss fights, either. It's a good game, but about twice as long as it has any right to be.

>> No.13080160

>>13080145
I know it's you schizo.

>> No.13080180

"embership" is such a retarded name

>> No.13080185

>>13080104
It's no big deal bro. She can just nuke the VOD later as is Ethyria tradition.

>> No.13080187

>Cant play DMC with the music
>Hololive played it with it
???

>> No.13080212

>>13080104
she's still playing the first day lol

>> No.13080221

>>13080187
Hololive and Nijisanji have different permissions anon.

>> No.13080231

>>13080185
then archive it fuckers, there will be zero evidence of the stuff she said in the beginning then.

>> No.13080241 [DELETED] 
File: 397 KB, 396x464, file.png [View same] [iqdb] [saucenao] [google]
13080241

>>13080058
If I was Biff would I see myself as similar to this board? Nope. You faggots are exactly the same.

https://nyfco.org/reimu-zense/
https://nyfco.org/nina-zense/

Have some nina faggots.

>> No.13080271 [DELETED] 

>>13080241
Where the fuck is her neck?????????????

>> No.13080277 [DELETED] 

>>13080241
Schizo.

>> No.13080281 [DELETED] 

>>13080241
Biff you fucking asshole. Kys

>> No.13080292
File: 94 KB, 1048x955, BobRose.jpg [View same] [iqdb] [saucenao] [google]
13080292

>>13080126
me too Rosebro

>> No.13080297
File: 1.64 MB, 958x2048, 1624768806331.png [View same] [iqdb] [saucenao] [google]
13080297

>> No.13080311

>>13080187
>Hololive played it with it
Just checked gura DMC4 stream from Nov 12th
NO FUCKING MUSIC

>> No.13080314

>>13080157
>I was a little worried she might drop it mid-way
>and then she played it for 7 hours, full immersed
but i agree with the rest. It seems that the first game didn't age well as the second one

>> No.13080321

>>13080221
Yeah. For some reason, Hololive can't play Dark Souls games, but NijiEN can. (DS3, at least).

>> No.13080327

Reminder that doxxfags are subhuman

>> No.13080343

>>13080327
HSKW fag is based tho

>> No.13080361

Is biff cute irl?

>> No.13080368

>>13080343
kys

>> No.13080373

>>13080321
Which sucks since my kamioshi loves the DS series but will never be able to stream at.
Oh well at least Rosemi will stream DS1 next year.

>> No.13080379

https://streamable.com/jwtbrn

>> No.13080392

>>13080311
All that matters for streaming is DM5 with music... sad but true...

>> No.13080398

I went to sleep when Millie started ranting about haters. Did she say anything important later?

>> No.13080412

>>13080321
Im sure Hololive can but wont cause they would need to disable monetization like Niji does.

>> No.13080429

I just woke up guys, should I watch streams!?!?

>> No.13080436

JP falseflaggers deserve to be necked....

>> No.13080456

>>13080398
Gave the classic smug "you still watch me" streamer talk then gave basic advise about credit and how she used it to buy scraps to eat.

>> No.13080468

>>13080398
She complained about having to buy food on credit because she's poor, usual supabait stuff

>> No.13080499

>>13080429
No, just shitpost in the thread like me! Remember to always watch the threads!

>> No.13080504

>>13080327
Uncle biff approves this message and how 4chan is a safespace for positive discussion.

>> No.13080516
File: 51 KB, 1024x666, Gosling 5.jpg [View same] [iqdb] [saucenao] [google]
13080516

>Bento member stream next week

>> No.13080541

>>13080412
If they had permissions, they would restore the old VODS

>> No.13080551

she didn't censor the end of the trial...

>> No.13080558

Going through the lazuli6ht hashtag, only Pomudachis and a singular Ryuguard done something for their oshis. Famelirakeks wha happun?

>> No.13080559

>>13080516
Is her mom going to help?

>> No.13080605

>>13080551
well goodbye VOD

>> No.13080617
File: 56 KB, 674x708, Amelia 12.jpg [View same] [iqdb] [saucenao] [google]
13080617

>another week that i will destroy my sleep schedule to watch Selen because of the Apex scrims

>> No.13080633

>>13080504
Remember when biff liked that one doxx paindora tweet?

>> No.13080651
File: 936 KB, 357x446, 1612900655027.webm [View same] [iqdb] [saucenao] [google]
13080651

>>13080551
AHAHAHAHAHAHAHAHAHA RETARDED BITCH

>> No.13080655

>>13080551
Did someone record her stream? We need to get those rrat clips

>> No.13080663

>>13080617
>Watching apex
You deserve every bit of pain you feel

>> No.13080684

>>13080551
actually technically the trial was just put off for further investigation so maybe it's alright?

>> No.13080691

>>13080551
dumbass, she doesn't need to censor the end of the first day of trial

>> No.13080693

>>13080663
>Watching Apex
nope
>watching Selen
Yes

>> No.13080721

>>13080551
It's the end of the first day retard, the trial isn't over

>> No.13080720

>>13080456
I don't watch her tho, never give her any view, I only used this thread as information lol

>> No.13080730
File: 160 KB, 800x800, 94144619.webm [View same] [iqdb] [saucenao] [google]
13080730

>> No.13080732

Millie it's literally a VN, this is literally what VNs are... some gameplay mechanic plus a visual narrative

>> No.13080740

Is that Mario Kart collab today?

>> No.13080743
File: 109 KB, 1500x1500, Selinlol 2.jpg [View same] [iqdb] [saucenao] [google]
13080743

wtf is this schizo dream KEK
>Pikamee

>> No.13080756

>>13080720
Based. Why watch streams when retards will willingly spoonfeed stuff to antis?

>> No.13080757

>>13080436
This thread should be smart enough to not fall for obvious falseflaggers right?

>> No.13080762

>>13080730
Penhomos have destroyed the well earned past reputation of Pentomos, i will never recover....

>> No.13080767

>>13080633
Where does it again, I will become ubereat driver to find out Elira's house

>> No.13080778
File: 226 KB, 2244x1664, EyrK4G2UcAEHond.jpg [View same] [iqdb] [saucenao] [google]
13080778

>>13080757

>> No.13080782
File: 85 KB, 800x800, 92241784_p0.png [View same] [iqdb] [saucenao] [google]
13080782

>> No.13080802
File: 258 KB, 1424x802, 1630154703759.jpg [View same] [iqdb] [saucenao] [google]
13080802

>>13080757

>> No.13080805

>>13080558
>Famelirakeks wha happun?
Probably lurking in their discord planning something cringy for their oshi again.

>> No.13080810
File: 112 KB, 734x1038, FERSplTXIAEYlMP.jpg [View same] [iqdb] [saucenao] [google]
13080810

FISH LOVE!!!

>> No.13080812

>>13080617
I love Selen and her Apex streams, but I've never been fond of tournament streams in general from anyone.

>> No.13080815

>>13080558
Elirakeks are all seanig

>>
Name
E-mail
Subject
Comment
Action